PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_141020_ttrx.t1
Common NameSOVF_141020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family GATA
Protein Properties Length: 364aa    MW: 40486.1 Da    PI: 6.7465
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_141020_ttrx.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.11e-17247281135
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                        C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Sp_141020_ttrx.t1 247 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 281
                        99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169926.2E-751337IPR016679Transcription factor, GATA, plant
SMARTSM004018.9E-18241291IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.451241277IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.42E-15245304No hitNo description
Gene3DG3DSA:3.30.50.103.7E-14245279IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.88E-14246293No hitNo description
PROSITE patternPS003440247272IPR000679Zinc finger, GATA-type
PfamPF003201.4E-15247281IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MEASSVSEFG QLTLTPERRL SCDPFIVEDL LDFSNDDDNH NLNGLILHDI NNNNDINNVP  60
FDNHHNSNSD SSNVVTPVDS CNSSFSGNND SIFPVTGDIG SHFSGELGVP YDELAELEWL  120
SNFVEESFSS EDLNKFHLIP TISAMKTRTD DRSETRFYPS EPTRTVTVPT SPIFSPEMSV  180
PGKARSKRSR AAPCNWASRL LVLAPGSSEQ VPVTKPVKPA GSKKKGLGLG GVGTIVDPNS  240
GGEVRKCLHC ATDKTPQWRT GPMGPKTLCN ACGVRYKSGR LVPEYRPAAS PTFMLTKHSN  300
SHRKVVELRR QKELMRQQQM QHQHQYQQQL IHHNPNNSSN MMFNPSNGDD YLIHQIGPDY  360
RQLI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010668515.10.0PREDICTED: GATA transcription factor 12-like
SwissprotP697812e-86GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A0K9QTY10.0A0A0K9QTY1_SPIOL; Uncharacterized protein
STRINGPOPTR_0006s25410.11e-112(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.11e-81GATA transcription factor 12